- sen15 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89888
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: EERGDSEPTP GCSGLGPDGV RGFGDGGGAP SWAPEDAWMG THPKYLEMME LDIGDATHVY VAFLVYLDLM ESK
- 0.1 ml
- Unconjugated
- Rabbit
- C1orf19, PCH2F, sen15
- sen15
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- tRNA splicing endonuclease subunit 15
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Proteases & Other Enzymes
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Specifications/Features
Available conjugates: Unconjugated